BPG is committed to discovery and dissemination of knowledge
Topic Highlight
©2014 Baishideng Publishing Group Inc.
World J Gastroenterol. Aug 14, 2014; 20(30): 10305-10315
Published online Aug 14, 2014. doi: 10.3748/wjg.v20.i30.10305
Table 1 Amino acid sequence alignment of Bowman-Birk inhibitor-like proteins from several legumes species
SpeciesEntry name (accession number)Amino acid sequence
Dolichos biflorusIBB_DOLBI (Q9S9E3)EPSESSKPCCDQCTCTKSIPPQCRCTDVRLNSCHSACSSCVCTFSIPAQCVCVDMKDFCYAPCKSSHDD
Glycine maxIBB1_SOYBN (P01055)DDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDKEN
IBBD2_SOYBN (P1064)DDEYSKPCCDLCMCTRSMPPQCSCEDIRLNSCHSDCKSCMCTRSQPGQCRCLDTNDFCYKPCKSRDD
IBBC2_SOYBN (P01063)DDESSKPCCDLCMCTASMPPQCHCADIRLNSCHSACDRCACTRSMPGQCRCLDTTDFCYKPCKSSDEDDD
Lens culinarisIBB_LENCU (Q8W4Y8)GDDVKSACCDTCLCTRSQPPTCRCVDVRESCHSACDKCVCAYSNPPQCQCYDTHKFCYKACHNSEIEE
Lupinus albusIBB1_LUPAL (P85172)SLASKPCCDSCLCTRSIPPQCRCTDIGETCHSACKSCICTRSFPPQCRCSDITHFCYKPCTSS
Phaseolus vulgarisIBB2_PHAVU (P01060)EPSESSEPCCDICVCTASIPPICQCTDVRLNSCHSACKSCMCTRSMPGKCRCLDTTDYCYKSCKSSGEDDD
IBB3_PHAVU (P81484)ASXSSKPCCBHCACTKSIPPQCRCSBLRLNSCHSECKGCICTFSIPAQCICTDTNNFCYEPCKSSHGPBBNN
Pisum sativumIBBA_PEA (Q41065)GDDVKSACCDTCLCTKSNPPTCRCVDVRETCHSACDSCICAYSNPPKCQCFDTHKFCYKACHNSEVEEVIKN
IBB2_PEA (Q41066)GDDVKSACCDTCLCTKSDPPTCRCVDVGETCHSACDSCICALSYPPQCQCFDTHKFCYKACHNSEVEE VIKN
IBBB_PEA (P56679)GDDVKSACCDTCLCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFDTQKFCYKACHNSELEEVIKN
Vicia fabaIBB_VICFA (P24661)GDDVKSACCDTCLCTKSEPPTCRCVDVGERCHSACNSCVCRYSNPPKCQCFDTHKFCYKSCHN
Vigna unguiculataIBB_VIGUN (P17734)ZASZSSKPCCRZCACTKSIPPZCRCSZVRLNSCHSACKSCACTFSIPAZCFCGBIBBFCYKPCKSSHSBBBBWN
Table 2 Preclinical studies showing colorectal chemopreventive properties of Bowman-Birk inhibitor-like proteins from several legume species
Species (common name)Model system (carcinogen)Effect and/or mechanisms of actionRef.
Glycine max (soy)Rodent colon carcinogenesis (DMH)Soybean BBI is effective at concentrations as low as 10 mg/100 g diet in reducing the incidence and frequency of colorectal tumors. Its ability to inhibit serine proteases is required for their chemopreventive properties. No adverse effects are observed in treated animals[52,53]
Mouse colorectal carcinogenesis (DMH)Soybean BBI, when simultaneously treated with DMH, prevent the development of neoplastic lesions and protect against the onset of severe inflammatory processes[79]
Mouse colon inflammation (DSS)A soybean Bomwan-Birk inhibitor concentrate reduces colon inflammation in mice with induced ulcerative colitis. Lower mortality rates and delayed onset of mortality are observed[58]
Colon cancer cell proliferationThe antiproliferative properties of BBI isoinhibitors, IBB1 and IBBD2, reveal that both trypsin- and chymotrypsin–like proteases involved in carcinogenesis should be considered as potential targets
[26]
Lens culinaris (lentil)Colon cancer cell proliferationLentil BBI is able to inhibit the growth of HT29 colon cancer cells at concentrations as low as 19 μmol/L, in a concentration-dependent manner; by contrast, colonic fibroblast CCD-18Co cells are unaffected[30]
Pisum sativum (pea)Colon cancer cell proliferationTI1B, a major pea protease inhibitor, affect in a dose-dependent manner the growth of HT29 colon cancer cells whereas an inactive mutant did not show any significant effect[55]
Vicia faba (field bean)Mouse stomach carcinogenesis (benzopyrene)BBI proves to be biologically active, under acidic conditions, in suppressing benzopyrene-induced forestomach carcinogenesis in mice following oral treatment; the oncopreventive properties are related to its protease inhibitory activity[93]
Table 3 Serine proteases as potential therapeutic targets of Bowman-Birk inhibitor-like proteins in pathological processes
Serine proteaseFunctionPathological processesEvidence of interaction with BBI-like proteins
ProteasomeControl of the turn-over of regulatory proteins involved in critical cellular processes including cell cycle progression, cell development and differentiation, apoptosis, angiogenesis and signaling pathwaysCancer, inflammatory processes, autoimmune diseases and agingSoybean BBI specifically and potently inhibits the proteasomal chymotrypsin-like activity in vitro and in vivo in MCF7 cancer breast cells[76]
Mice treated simultaneously with BBI and DMH show a significant decrease in the chymotrypsin- and trypsin-like proteasomal activity in comparison with those treated with DMH only[79]
Soybean BBI suppress proteasomal chymotrypsin-like activity in U2OS human osteosarcoma cells in vitro[80]
MatriptaseDifferentiation and function of epithelial tissuesActivator of critical molecules associated with tumor invasion and metastasisSFTI-1, a cyclic peptide from sunflower having similar features to the trypsin inhibitory binding domain of BBI, is a very potent inhibitor (Ki: 0.92 nmol/L)[85]
BBI from soybean and lima bean have been reported to inhibit matriptase activity in vitro[86]
ChymaseKey mediator in inflammatory cell signaling pathwaysInflammatory processes, allergic reactions and pulmonary fibrosisSoybean BBI strongly inhibits chymase from rat mast cells (Ki: 13.2 nmol/L)[94]
Soybean BBI is a highly effective inhibitor of human mast cell chymase, being not effective against human tryptase[88]
Cathepsin GDegradation of extracellular matrix components, regulates inflammatory response and promotes apoptosisInflammatory processes, cancer and agingSoybean BBI inhibits strongly cathepsin G (Ki: 1.2 nmol/L)[86]
DuodenaseMorphogenesis and tissue repair; inflammatory and mitogenic role; participation in activation cascade of digestive proteasesInflammatory processesDuodenase interacts specifically with the chymotrypsin inhibitory domain of soybean BBI (Ki: 4 nmol/L)[87]
ElastaseDegradation of extracellular matrix componentsPulmonary emphysema, cystic fibrosis, infections, inflammation and atherosclerosisSoybean BBI inhibits hydrolysis of extracellular matrix components by leukocyte enzymes[95]
Soybean BBI inhibit human leukocyte elastase (Ki: 2.3 nmol/L)[96]


Write to the Help Desk